Modified GHRH 1-29 analogue
The same modified GHRH backbone as CJC-1295 (DAC) but lacking the albumin-binding maleimide. ~30 minute serum half-life.
| Compound | CJC 1295 (without DAC) |
| Research category | GHRH / Secretagogue Research |
| Available sizes | 10mg |
| Pricing | From £44 |
| Format | Lyophilised powder in sealed vial |
| Purity | >99% by HPLC (Janoshik Analytical, batch-verified) |
| Intended use | In-vitro laboratory research only. Not for human consumption. |
Reference data drawn from public databases (PubChem, UniProt) and peer-reviewed literature. For research and laboratory characterisation only.
| Compound class | Synthetic GHRH analogue (Modified GRF 1-29) without DAC modification |
| Molecular formula | C152H252N44O42 |
| Molecular weight | 3367.9 g/mol |
| CAS Registry Number | 863288-34-0 |
| Number of residues | 29 |
| Amino acid sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 with D-Ala²-Gln⁸-Ala¹⁵-Leu²⁷ substitutions. |
| Receptor / mechanism | GHRH receptor agonist (modified GHRH 1-29). |
| Reported half-life | Reported ~30 minutes in human serum. |
| Solubility | Lyophilised powder reconstitutes in bacteriostatic water for laboratory use. |
| Storage (lyophilised) | Stable at 2–8 °C lyophilised for 24+ months. |
| Storage (reconstituted) | Reconstituted: store at 2–8 °C, use within 14 days. |
| Clinical / regulatory status | Investigational research compound. |
CJC 1295 without DAC, also known in the literature as Mod GRF 1-29, is a synthetic GHRH analogue comprising the first 29 amino acids of GHRH with four amino-acid substitutions for stability. Supplied as lyophilised powder for in-vitro research use only.
The above describes how this compound is characterised in the published peer-reviewed literature. It is not a claim about effects in humans.
CJC 1295 (without DAC) is supplied as a lyophilised (freeze-dried) powder in a sealed glass vial. For laboratory reconstitution, add the desired volume of diluent (typically bacteriostatic water) slowly down the side wall of the vial. Swirl gently until fully dissolved - do not vortex or shake. Store reconstituted solutions at 2–8 °C and use within 4–6 weeks.
Use our Reconstitution Volume Calculator to compute the resulting mg/ml concentration.
| State | Temperature | Shelf life |
|---|---|---|
| Lyophilised | 2–8 °C or −20 °C | Up to 24 months |
| Reconstituted | 2–8 °C | 4–6 weeks typical |
Every batch of CJC 1295 (without DAC) we supply is independently HPLC-verified by Janoshik Analytical. Where a Janoshik report has been issued for the current batch it is supplied with the order and carries a unique verification key that can be authenticated against Janoshik's records. Reported purity is consistently above 99%.
Latest Janoshik report for CJC-1295 (no DAC) 10mg · task #231387 · analysed 29 Sep 2026
This report is for the batch. Janoshik’s HPLC test measures what the compound is and how pure it is, and its quantification confirms the amount in the vial tested. The report supplied with your order carries a verification key you can check on Janoshik’s own site.
| Purity | 99.239% |
| Measured content | 9.92 mg |
| Batch | L77CJCND2612 |
| Verification key | E3QKZREF4RDU |
Researchers working with CJC 1295 (without DAC) often work alongside the following compounds in the preclinical literature:
Chemical and reference data for Cjc1295 No Dac is drawn from public chemical registries (CAS, PubChem) and the independent peer-reviewed literature. All sources are third-party and independently verifiable; Lab77 Peptides is not affiliated with the cited publications or databases.